General Information

  • ID:  hor007123
  • Uniprot ID:  Q08731??24-173)
  • Protein name:  Lithostathine-2
  • Gene name:  TTR; QccE-10711, QccE-14396;
  • Organism:  Mus musculus
  • Family:  NA
  • Source:  Animal
  • Expression:  Expressed only in regenerating islets and normal exocrine pancreas; but not in normal pancreatic islets. Expressed strongly in pancreas; weakly in liver; but not at all in gall bladder.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Mus; Mus; Mus musculus (Mouse)
  • GO MF:  GO:0062023 collagen-containing extracellular matrix; GO:0005615 extracel
  • GO BP:  GO:0042834 peptidoglycan binding; GO:0038023 signaling receptor activity; GO:0070492 oligosaccharide binding
  • GO CC:  GO:0001967 suckling behavior; GO:0043434 response to peptide hormone; GO:0008284 positive regulation of cell population proliferation; GO:0042552 myelination; GO:0061844 antimicrobial humoral immune response mediated by antimicrobial peptide

Sequence Information

  • Sequence:  VAEEDFPLAEKDLPSAKINCPEGANAYGSYCYYLIEDRLTWGEADLFCQNMNAGHLVSILSQAESNFVASLVKESGTTASNVWTGLHDPKSNRRWHWSSGSLFLFKSWATGAPSTANRGYCVSLTSNTAYKKWKDENCEAQYSFVCKFRA
  • Length:  150
  • Propeptide:  MAQNNVYLILFLCLMFLSYSQGQVAEEDFPLAEKDLPSAKINCPEGANAYGSYCYYLIEDRLTWGEADLFCQNMNAGHLVSILSQAESNFVASLVKESGTTASNVWTGLHDPKSNRRWHWSSGSLFLFKSWATGAPSTANRGYCVSLTSNTAYKKWKDENCEAQYSFVCKFRA
  • Signal peptide:  MRVVLLASAVLCLLAGQVLS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life: Half-Life Yeast:
Half-Life E.Coli: Aliphatic Index
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA